- TMEM19 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90422
- Rabbit
- Human
- TMEM19
- 0.1 ml
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: YTGLDESTGM VVNSPTNKAR HIAGKPILDN
- Unconjugated
- transmembrane protein 19
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
YTGLDESTGMVVNSPTNKARHIAGKPILDN
Specifications/Features
Available conjugates: Unconjugated